PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G027400.1
Common NamePOPTR_0005s02750g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YB
Protein Properties Length: 150aa    MW: 16786.7 Da    PI: 5.6943
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G027400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB158.31.2e-49498397
               NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                        eqdr+lPianv+r+mkk+lP  akisk+ak+t+qec++ef+sfvt+easdkcq+e+rkt+ngdd++wal +lGf+d++e++  yl+kyre+e+
  Potri.005G027400.1  4 EQDRLLPIANVGRMMKKILPPTAKISKEAKQTMQECATEFVSFVTGEASDKCQKENRKTVNGDDICWALISLGFDDHAEAMVRYLHKYREAER 96
                        8*******************************************************************************************9 PP

               NF-YB 96 ek 97
                        e+
  Potri.005G027400.1 97 ER 98
                        97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.7E-503123IPR009072Histone-fold
SuperFamilySSF471132.31E-375119IPR009072Histone-fold
PfamPF008083.7E-26872IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.9E-153654No hitNo description
PRINTSPR006151.9E-155573No hitNo description
PRINTSPR006151.9E-157492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MDDEQDRLLP IANVGRMMKK ILPPTAKISK EAKQTMQECA TEFVSFVTGE ASDKCQKENR  60
KTVNGDDICW ALISLGFDDH AEAMVRYLHK YREAERERST NQHKASGTDQ GEESNHESKQ  120
PKQPIEAPNN GVEFRVLEKG NSSSFTNPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-40493392Transcription factor HapC (Eurofung)
4g92_B2e-40493392Transcription factor HapC (Eurofung)
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00133DAPTransfer from AT1G09030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006382502.11e-110hypothetical protein POPTR_0005s02750g
SwissprotO040272e-57NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLB9N4G41e-110B9N4G4_POPTR; Uncharacterized protein
STRINGPOPTR_0005s02750.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.11e-58nuclear factor Y, subunit B4